PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009796718.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 399aa    MW: 44801.3 Da    PI: 4.923
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009796718.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51291561128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yL++k+ gk++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ dkky +g+r nrat +gyWkatgkd+ v 
  XP_009796718.1  29 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVTEIDVYKSEPWELAEysSLKSRDLEWYFFSPVDKKYGNGSRLNRATGQGYWKATGKDRFVR 122
                     579*************************99.88**************84346777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + k++++g+kktLvf++grap+g++t+Wvmheyrl
  XP_009796718.1 123 H-KSQTIGMKKTLVFHSGRAPDGQRTNWVMHEYRL 156
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6223179IPR003441NAC domain
PROSITE profilePS5100557.8229179IPR003441NAC domain
PfamPF023653.9E-2831156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEQEGSLVVV VAAAGAVTVA APARAPTSLA PGFRFHPTDE ELVRYYLRRK ACGKPFRFQA  60
VTEIDVYKSE PWELAEYSSL KSRDLEWYFF SPVDKKYGNG SRLNRATGQG YWKATGKDRF  120
VRHKSQTIGM KKTLVFHSGR APDGQRTNWV MHEYRLADEE LEKAGIVQDS FVLCRIFQKS  180
GLGPPNGDRY APFVEEEWDD DVAMIPGGEA EDDMANGDEA RVEGNDLDQD ALRKAPRYIE  240
NLIEPQSLPF VCKRESSEDA ELLSLSQSKR SKHDDPSSSR VNGSEDSTIT SQDPPTTMMT  300
KTNCSPTLLG FPLLESTETK EGQPSNPPTF DSSNLEKSVP PGYLKFISNL ENGILNVSME  360
RETLKIEVMR AQAMINLLQS RVDLLTKENE DMRRIVREG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-522817919168NAC domain-containing protein 19
3swp_C3e-522817919168NAC domain-containing protein 19
3swp_B3e-522817919168NAC domain-containing protein 19
3swp_A3e-522817919168NAC domain-containing protein 19
3swm_D3e-522817919168NAC domain-containing protein 19
3swm_C3e-522817919168NAC domain-containing protein 19
3swm_B3e-522817919168NAC domain-containing protein 19
3swm_A3e-522817919168NAC domain-containing protein 19
4dul_B3e-522817916165NAC domain-containing protein 19
4dul_A3e-522817916165NAC domain-containing protein 19
1ut7_B3e-522817916165NO APICAL MERISTEM PROTEIN
1ut7_A3e-522817916165NO APICAL MERISTEM PROTEIN
1ut4_B3e-522817916165NO APICAL MERISTEM PROTEIN
1ut4_A3e-522817916165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796718.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016464323.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K002e-92NAC78_ARATH; NAC domain-containing protein 78
TrEMBLQ8LRL70.0Q8LRL7_PETHY; Nam-like protein 8
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.23e-96NAC domain containing protein 52